var neededkeys = [76, 79, 71, 77, 69, 73, 78]; ', 'ajax'); "context" : "envParam:quiltName", }, "parameters" : { "event" : "expandMessage", Im WoT Forum hat einer geschrieben, er hat die Zeitung gekauft, sich an den WoT Support gewandt, weil der Code nicht funzte und die konnten sagen, daß er es am 8. versucht hat mit dem Code und auch, welcher Account den schon am 7. aktiviert hat. LITHIUM.SearchAutoCompleteToggle({"containerSelector":"#searchautocompletetoggle_77ab60b66e6881","enableAutoCompleteSelector":".search-autocomplete-toggle-link","enableAutocompleteSuccessEvent":"LITHIUM:ajaxSuccess:enableAutoComplete","disableAutoCompleteSelector":".lia-autocomplete-toggle-off","disableAutocompleteSuccessEvent":"LITHIUM:ajaxSuccess:disableAutoComplete","autoCompleteSelector":".lia-autocomplete-input"}); { "initiatorDataMatcher" : "data-lia-kudos-id" { "actions" : [ { { "action" : "rerender" "action" : "rerender" "context" : "envParam:feedbackData", "event" : "MessagesWidgetEditAction", ] "disableLinks" : "false", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_30","feedbackSelector":".InfoMessage"}); ] }, "actions" : [ "actions" : [ "initiatorDataMatcher" : "data-lia-kudos-id" ], "context" : "envParam:quiltName,message", "linkDisabled" : "false" "action" : "rerender" } ], } { ] "}); "event" : "MessagesWidgetEditAction", "event" : "editProductMessage", ], ] // console.log(key); "disableLabelLinks" : "false", ] LITHIUM.AjaxSupport.fromForm('#form_4', 'GiveRating', '#ajaxfeedback_4', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "displaySubject" : "true", "action" : "rerender" LITHIUM.Auth.KEEP_ALIVE_TIME = 300000; "action" : "addClassName" "includeRepliesModerationState" : "false", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } "truncateBodyRetainsHtml" : "false", { $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "event" : "editProductMessage", "actions" : [ watching = true; { LITHIUM.InputEditForm("form_2", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "action" : "rerender" ] { }, } ] } }, { "actions" : [ "event" : "MessagesWidgetEditCommentForm", } "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", var key = e.keyCode; element.removeClass('active'); "useSubjectIcons" : "true", { LITHIUM.Dialog.options['-46044607'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; ], "action" : "rerender" { { "event" : "QuickReply", { LITHIUM.StarRating('#any_0_1', true, 2, 'LITHIUM:starRating'); } "context" : "", "event" : "unapproveMessage", "actions" : [ ], "event" : "MessagesWidgetEditAction", LITHIUM.AjaxSupport.useTickets = false; } return; { "displayStyle" : "horizontal", var ctaHTML = '. "event" : "addMessageUserEmailSubscription", "context" : "envParam:quiltName,message", "}); Sonstige Cams 30. ] ] "context" : "", Das Mediastreaming auf der GigaTV Box von Geräten im Netzwerk klappt nämlich einwandfrei in 1080p. "actions" : [ }, "eventActions" : [ ich bin vor 3 wochen von t**m zu vodafone gewechselt, da ich von diesem anbieter (schwierigkeiten mit der magenta), satt hatte. "action" : "rerender" //$('#vodafone-community-header').css('display','block'); "action" : "rerender" "componentId" : "forums.widget.message-view", }, { "disableLabelLinks" : "false", "actions" : [ { ] "context" : "", { { "action" : "rerender" LITHIUM.AjaxSupport.fromForm('#form_5', 'GiveRating', '#ajaxfeedback_5', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "context" : "", $(this).removeClass('active'); LITHIUM.AjaxSupport.ComponentEvents.set({ "disableKudosForAnonUser" : "false", }, "action" : "rerender" } "triggerEvent" : "click", "action" : "rerender" } }, "message" : "1983033", "actions" : [ }, Watching DAZN DAZN encountered an error (10-000-000) DAZN encountered an error (10-000-000) This error message means that DAZN has encountered an error. "kudosLinksDisabled" : "false", { { ', 'ajax'); { } "event" : "addMessageUserEmailSubscription", { ] } { } } { if ( key == neededkeys[0] ) { ] }, "context" : "", lithstudio: [], "action" : "rerender" LITHIUM.InputEditForm("form_1", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. Bist du sicher, dass du fortfahren möchtest? "quiltName" : "ForumMessage", return; } LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_1","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_1","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/GigaTV/thread-id/6927","ajaxErrorEventName":"LITHIUM:ajaxError","token":"i1QrrX0PpaEHBKog9JykhAtocZdS3zsswNyd7pxsofg. { ] { "context" : "", { "forceSearchRequestParameterForBlurbBuilder" : "false", }); "action" : "rerender" LITHIUM.StarRating('#any_4', false, 1, 'LITHIUM:starRating'); "actions" : [ }, ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_24","feedbackSelector":".InfoMessage"}); } "event" : "ProductAnswer", { { Ein Fehler ist auf DAZN aufgetreten. { { "context" : "", ] } "useSubjectIcons" : "true", "truncateBodyRetainsHtml" : "false", "actions" : [ "actions" : [ "action" : "rerender" { })(LITHIUM.jQuery); } LITHIUM.StarRating('#any_0_3', true, 2, 'LITHIUM:starRating'); "forceSearchRequestParameterForBlurbBuilder" : "false", "actions" : [ ] { "actions" : [ // enable redirect to login page when "logmein" is typed into the void =) ] LITHIUM.Dialog.options['-1040003818'] = {"contentContext":"valuesurveys.widget.survey-prompt-dialog","dialogOptions":{"minHeight":399,"draggable":false,"maxHeight":800,"resizable":false,"autoOpen":false,"width":610,"minWidth":610,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modal-simple lia-panel-dialog-modal-valuesurvey","position":["center","center"],"modal":true,"maxWidth":610,"ariaLabel":"Feedback for community"},"contentType":"ajax"}; var cookieDomain = 'forum.vodafone.de'; }); { }, "action" : "rerender" ] "action" : "rerender" "displaySubject" : "true", }, ] { LITHIUM.StarRating('#any_5', false, 1, 'LITHIUM:starRating'); { "actions" : [ { "quiltName" : "ForumMessage", "useCountToKudo" : "false", "event" : "kudoEntity", "truncateBody" : "true", { LITHIUM.UserListActual({"acceptedSolutionsColumnSelector":".UserList .lia-list-row .acceptedSolutionsCountColumn","kudosColumnSelector":".UserList .lia-list-row .kudosCountColumn"}); ] "context" : "", ', 'ajax'); "action" : "rerender" { "actions" : [ { $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "actions" : [ { "context" : "", { }, { "action" : "rerender" "actions" : [ }, LITHIUM.PartialRenderProxy({"limuirsComponentRenderedEvent":"LITHIUM:limuirsComponentRendered","relayEvent":"LITHIUM:partialRenderProxyRelay","listenerEvent":"LITHIUM:partialRenderProxy"}); "message" : "1983083", LITHIUM.MessageBodyDisplay('#bodyDisplay_5', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "useTruncatedSubject" : "true", ] ] "includeRepliesModerationState" : "false", } "actions" : [ "actions" : [ "context" : "", LITHIUM.Dialog.options['-947183039'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "}); "action" : "rerender" "event" : "MessagesWidgetEditCommentForm", "event" : "MessagesWidgetMessageEdit", }); LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1982985 .lia-rating-control-passive', '#form_0'); }, "linkDisabled" : "false" { "parameters" : { } }, "action" : "rerender" } "event" : "MessagesWidgetEditAnswerForm", }); "kudosLinksDisabled" : "false", LITHIUM.StarRating('#any_0_2', true, 2, 'LITHIUM:starRating'); "action" : "rerender" "context" : "envParam:quiltName,message,product,contextId,contextUrl", "event" : "kudoEntity", ] "disallowZeroCount" : "false", element.children('ul').slideDown(); "event" : "removeMessageUserEmailSubscription", { "action" : "rerender" { // --> }, { "action" : "rerender" "initiatorBinding" : true, "actions" : [ } ] "messageViewOptions" : "1111110111111111111110111110100101001101" LITHIUM.Cache.CustomEvent.set([{"elementId":"link_5","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1982680}},{"elementId":"link_9","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1982985}},{"elementId":"link_13","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1983033}},{"elementId":"link_17","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1983083}},{"elementId":"link_21","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1983096}},{"elementId":"link_25","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1983686}},{"elementId":"link_29","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2054790}},{"elementId":"link_32","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2516470}},{"elementId":"link_33","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2543305}},{"elementId":"link_34","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2535260}},{"elementId":"link_35","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2520392}},{"elementId":"link_36","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2565294}},{"elementId":"link_38","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2565045}},{"elementId":"link_39","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2565007}},{"elementId":"link_40","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2564934}},{"elementId":"link_41","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2564070}},{"elementId":"link_43","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2563878}},{"elementId":"link_44","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2563869}},{"elementId":"link_45","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2563806}},{"elementId":"link_46","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2563764}},{"elementId":"link_47","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2563708}},{"elementId":"link_48","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2563435}}]); LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1983033 .lia-rating-control-passive', '#form_1'); "actions" : [ ;(function($) { "action" : "rerender" } } "event" : "MessagesWidgetMessageEdit", "context" : "", "actions" : [ "event" : "editProductMessage", "event" : "unapproveMessage", { ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "event" : "ProductMessageEdit", "actions" : [ $('.js-close-header-announcement').on('click', clickHandler); "useSubjectIcons" : "true", } { }, $('#vodafone-community-header .lia-button-wrapper-searchForm-action').toggleClass('active'); "initiatorDataMatcher" : "data-lia-message-uid" { $(event.data.selector).removeClass('cssmenu-open'); ] { ] "activecastFullscreen" : false, ;(function($) { "parameters" : { "action" : "rerender" } }, ] "event" : "RevokeSolutionAction", "actions" : [ } }, "event" : "ProductAnswerComment", "displaySubject" : "true", }, } { } "initiatorDataMatcher" : "data-lia-kudos-id" "event" : "ProductAnswerComment", "useCountToKudo" : "false", LITHIUM.StarRating('#any_0_5', true, 2, 'LITHIUM:starRating'); "action" : "addClassName" "actions" : [ "context" : "envParam:quiltName", "componentId" : "kudos.widget.button", { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_13","feedbackSelector":".InfoMessage"}); } { if ( neededkeys[count] == key ) { "action" : "rerender" "actions" : [ }, }, Der Kampf der Bundesregierung gegen die Corona-Pandemie hat das … "event" : "MessagesWidgetEditCommentForm", "context" : "", "initiatorDataMatcher" : "data-lia-kudos-id" { "actions" : [ { "context" : "", "truncateBodyRetainsHtml" : "false", "displayStyle" : "horizontal", return; }, "action" : "pulsate" "action" : "rerender" } }); ] { $(document).ready(function(){ count = 0; "event" : "RevokeSolutionAction", ', 'ajax'); { ] ] "context" : "envParam:quiltName,product,contextId,contextUrl", } } } ', 'ajax'); } else { })(LITHIUM.jQuery); ;(function($) { "action" : "pulsate" "actions" : [ "context" : "envParam:feedbackData", })(LITHIUM.jQuery); "context" : "envParam:quiltName,message", "event" : "MessagesWidgetMessageEdit", { "actions" : [ "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { "disableLabelLinks" : "false", { "context" : "envParam:feedbackData", "actions" : [ Hinweise: Geben Sie die SIP-ID ohne Leerzeichen und Sonderzeichen ein (entspricht Vorwahl und Rufnummer) "context" : "envParam:quiltName", { "event" : "RevokeSolutionAction", "event" : "ProductAnswer", { ] "actions" : [ "action" : "pulsate" } "forceSearchRequestParameterForBlurbBuilder" : "false", "event" : "removeThreadUserEmailSubscription", "event" : "MessagesWidgetEditCommentForm", "actions" : [ "action" : "rerender" }, "event" : "RevokeSolutionAction", "displaySubject" : "true", ;(function($) { "event" : "deleteMessage", "parameters" : { } { } "event" : "markAsSpamWithoutRedirect", "actions" : [ }, { var topicIdCustomAnnouncement = clickedDomElement.data("message-id"); "parameters" : { "actions" : [ ] "context" : "", { "event" : "ProductAnswer", })(LITHIUM.jQuery); /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ // --> "event" : "MessagesWidgetCommentForm", "actions" : [ ] { { "actions" : [ } }, "disableLabelLinks" : "false", "event" : "MessagesWidgetAnswerForm", } } } { { { "entity" : "1982680", \\n\\t\\t\\t\\n\\t\\n\\n\\t\\n\\n\\t\\t\";LITHIUM.AjaxSupport.defaultAjaxErrorHtml = \", \\n\\t\\t\\t\\t\\n\\n\\t\\t\\t\\t\\n\\t\\t\\t\\t\\t, '; "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", ] } "eventActions" : [ ] "actions" : [ { ] "action" : "rerender" LITHIUM.InputEditForm("form_5", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "actions" : [ "action" : "rerender" ] "context" : "", "context" : "", "kudosLinksDisabled" : "false", "includeRepliesModerationState" : "false", "context" : "envParam:quiltName,expandedQuiltName", { "closeEvent" : "LITHIUM:lightboxCloseEvent", } { ] "action" : "rerender" // console.log('watching: ' + key); { }, "actions" : [ { "action" : "pulsate" Zgemma I 55 3. "context" : "", } { Zwischen der Fritzbox und dem WR ist noch ein PowerLine Adapterin der Steckdose. "truncateBodyRetainsHtml" : "false", "event" : "addThreadUserEmailSubscription", ;(function($) { }, })(LITHIUM.jQuery); "context" : "lia-deleted-state", { "action" : "rerender" }); }, "context" : "", "displaySubject" : "true", LITHIUM.StarRating('#any_0_5', true, 2, 'LITHIUM:starRating'); "context" : "envParam:quiltName,message", ] Hilfe | Ein Fehler ist auf DAZN aufgetreten. }, "disallowZeroCount" : "false", "action" : "rerender" "actions" : [ "context" : "", "event" : "kudoEntity", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_29","feedbackSelector":".InfoMessage"}); "revokeMode" : "true", "action" : "pulsate" LITHIUM.Dialog({ } $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "event" : "removeThreadUserEmailSubscription", ] ] "event" : "MessagesWidgetEditAnswerForm", "initiatorBinding" : true, { "displayStyle" : "horizontal", LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_1","componentSelector":"#lineardisplaymessageviewwrapper_1","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1983033,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. ] ] "action" : "rerender" } "entity" : "1983686", LITHIUM.AjaxSupport.fromLink('#kudoEntity_1', 'kudoEntity', '#ajaxfeedback_1', 'LITHIUM:ajaxError', {}, '_kf1-aYD73HAIuhxYrOQFXy1rnRp989hkau1FViuDeI. "actions" : [ "action" : "pulsate" "useSubjectIcons" : "true", "context" : "", "kudosable" : "true", ] "event" : "AcceptSolutionAction", ;(function($) { LITHIUM.StarRating('#any_0_2', true, 2, 'LITHIUM:starRating'); { "entity" : "1983033", } "action" : "rerender" // If watching, pay attention to key presses, looking for right sequence. "actions" : [ } "actions" : [ "initiatorDataMatcher" : "data-lia-message-uid" ] "initiatorDataMatcher" : "data-lia-message-uid" "displayStyle" : "horizontal", "action" : "rerender" "componentId" : "forums.widget.message-view", } "action" : "rerender" "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", resetMenu(); { } "context" : "", LITHIUM.AjaxSupport.ComponentEvents.set({ "context" : "envParam:selectedMessage", { ], } } { "actions" : [ "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { "event" : "RevokeSolutionAction", { LITHIUM.Auth.API_URL = '/t5/util/authcheckpage'; } var ctaHTML = ''; ;(function($) { "context" : "", } "context" : "lia-deleted-state", "context" : "", "event" : "ProductAnswer", }, } { ] if ( watching ) { "context" : "envParam:quiltName", ] "actions" : [ { "event" : "ProductAnswer", ] { $(document).ready(function(){ "event" : "ProductMessageEdit", { { "action" : "rerender" "event" : "MessagesWidgetEditCommentForm", "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_34","feedbackSelector":".InfoMessage"}); return; Lade Dir Spiele bei Big Fish runter. $(document).ready(function(){ "disableLabelLinks" : "false", }, }, Bist du sicher, dass du fortfahren möchtest? } "actions" : [ "disableLinks" : "false", ] "displayStyle" : "horizontal", ], }); "event" : "RevokeSolutionAction", ] "action" : "pulsate" "context" : "", "actions" : [ { { "event" : "MessagesWidgetCommentForm", // Reset the conditions so that someone can do it all again. LITHIUM.InputEditForm("form_3", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "actions" : [ ] "event" : "addMessageUserEmailSubscription", Hinweise: Geben Sie die SIP-ID ohne Leerzeichen und Sonderzeichen ein (entspricht Vorwahl und Rufnummer) { ] "truncateBodyRetainsHtml" : "false", "event" : "markAsSpamWithoutRedirect", LITHIUM.MessageBodyDisplay('#bodyDisplay_4', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", GIGA bündelt die Themenseiten GIGA Apple, GIGA Android und GIGA Games. "actions" : [ ] } { ] }, "event" : "MessagesWidgetMessageEdit", "action" : "rerender" } ] { "forceSearchRequestParameterForBlurbBuilder" : "false", }, "componentId" : "kudos.widget.button", }, "action" : "rerender" }); { }, }, { "context" : "", { "action" : "rerender" }, resetMenu(); "actions" : [ "disallowZeroCount" : "false", "actions" : [ "action" : "rerender" //} else { "parameters" : { "context" : "envParam:quiltName,message,product,contextId,contextUrl", "actions" : [ "initiatorDataMatcher" : "data-lia-kudos-id" "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_29","feedbackSelector":".InfoMessage"}); { "displaySubject" : "true", "actions" : [ { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_25","feedbackSelector":".InfoMessage"}); "displayStyle" : "horizontal", "selector" : "#messageview_5", "context" : "", { "event" : "MessagesWidgetMessageEdit", }, "action" : "rerender" "context" : "", lithadmin: [] "actions" : [ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_34","feedbackSelector":".InfoMessage"}); }, "kudosable" : "true", "context" : "", "actions" : [ "action" : "rerender" ] ] { Informieren Sie sich hier über Stroh zu Gold! "action" : "rerender" { "action" : "pulsate" } "event" : "RevokeSolutionAction", } } "}); } var neededkeys = [76, 79, 71, 77, 69, 73, 78]; "entity" : "1983083", "showCountOnly" : "false", "event" : "MessagesWidgetAnswerForm", "disableLabelLinks" : "false", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_33","feedbackSelector":".InfoMessage"}); } { window.location.replace('/t5/user/userloginpage'); "action" : "rerender" "event" : "MessagesWidgetEditCommentForm", "action" : "rerender" ], LITHIUM.AjaxSupport.fromLink('#kudoEntity_2', 'kudoEntity', '#ajaxfeedback_2', 'LITHIUM:ajaxError', {}, 'ZJCovmgjkcRkwVRGq3k5DWfsCXamRoa4defz7bkr9Bs. } { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_5","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_5","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/GigaTV/thread-id/6927","ajaxErrorEventName":"LITHIUM:ajaxError","token":"A-vx28D3vhwUh-XCtYdSVv6LP6ONU_alK-D1HMqe6yM. "disableKudosForAnonUser" : "false", "actions" : [ { ] ;(function($) { }, "action" : "rerender" { "context" : "envParam:quiltName", "componentId" : "forums.widget.message-view", ]